Newspapers / The North-Carolina Star (Raleigh, … / March 12, 1835, edition 1 / Page 1
Part of The North-Carolina Star (Raleigh, N.C.) / About this page
This page has errors
The date, title, or page description is wrong
This page has harmful content
This page contains sensitive or offensive material
5 no. 12 XIALIZIGXX, XT. O. THOTISD AT, Xil ARCH 12; 1035 j.... J- be id ni ti iu aw Wat M 'i KW, eeli CO trl rtikt I Ik art packi aa.4 :M til the d ybki lt Iota I iiei Itlltltl! e fc" ill r war wwe f wkr liajajr laikli ..s.,.. a.!-.!' OCA iae l aad r ladmii 11 .nffprn . Q"Fi5TJ t ..r!i:'r Crol,a GazttU, : pcsuaata. witdl, I I.AWRKNCK & -I.KMAT? TKKMS. ..-:..,!. Hiumkcn mi-.lalt ni4taruu)ciwtiqwted.lUte,daimf the Ffvnch -were ".Mrf.. afterward, our limits kMnri7HNUH4M pa i hoi went were ronfiurd to the Mississtp- year1. wiri(.iKM. pi river South Carolina was sepa- tint. tijM br mMoiU mi! it- i..ii.eett for w iMiiwrniM. . (Mim iuuMiiMHiKM 8leb fV!jreTili,"Ea;. 1 (he House of Commons. n tho Sd nf January, 1 835, on the following resolutions, Introduced by Doctor llendersou: gewl.nt. ( the opinion af 'hi (.ener.it Aa- ,l,iy, I bhI any aet jr awn tne l,angrtt m LlUlICI 91MPI UI ,! IMC IUU1I wim m Slats in Wieh lUey are situate:, or any aet a hick the miaimam priee at which the ml art nnm Mid thall be rHufaI, onl. ee- mhIj affWet l ha prosperity of all the old Stale, l do great injtiee lo lhoe Stale by wlioia ry were original ly aeileil to me ueaieiieraey. Retnlreq further, a the opinio. M On leie- I Auoniuiy. i nt iae nuuiuvueoi niimt own iT(h,-r.,1M;.ll portion of ib pHbiia dibeM Uiiila anwtfftBrnri anc m.M AM tatabaih ara; waTly hrl.1 iem, 1 ,inz ihu been aeoinulihei, Oint eh ilutri- i . . . 1 ' 1 1 . l. . j. . 1 . unn 01 me puiis mii-it, wr i (iryw:'n mot- . niirlit to be maile aiflunr the State of . the iion, a (hall be proportioned lo the reineetire irifiaef anfTJ-'iftenililure Tneiirreif by Iheai In miort f the Unhed State, or. at le.it, In nro- rtronle llieir te4ert popiilatioir. - ""' Kenlfel, t'bat the tineii be, and he S Irek renueted to traaroit enpie of thete re- W llutiont to the Senator and HeireentalUe im tin State Ml we uoogre 01 h unneu t'e. Ma. Speakeii: The members of bis body will do me the justice to limit that 1 am not in the habit of cunytns; the floor often, or long at time; but I must beg their atten- J.01 at present lunger than usual, ice I ho subject now before us is lie of more importance to our State litMiltt it lead to any rarorable ac- L f'.nnrmVlliin miv measure ettl """" - mnJ lhich has been presented for consi Iration in. many years. It la do El! VaJijteJ.WlMiMBtJ ltention has not been heretofore di- kted to the invastigation of this bject, should at present learn 0 usli of its merits at least and be- lme so Tar acqnriilett with the puh- domain as to intorm, anil rouse the people to a sense of their hts. If, sir, the great masa of vo- iVa ! HiK Stfttes could once tret JLati to possession of the fai ts or this "f lse, there would scarcely he found L? Idisscutiog voice from Maine to i 111 rrr mi i "'''v iicU ourht to have been adopted in latino to the public lands. Mot at party spirit would be hushed tirely, but because no man count t a seat in Congress who was not ugcu to pursue a course simiiar nrinrinln tn tliat indicated in these Vulutions. Ooubtlcsa efforts Will I mado here tgive this queai ion P"fZ" by" in aonio indirect mode, r oy some evasivo tov, iiu u at effort should fairran attempt no ubt will follow, to make it a party lestion; for there are certain indi- Stiona by wiiit o ii own i injunv magician to discover the enemy's proHch. ,1 will promise, air, for one, wot to ke it a party question myself; and In other Tact, I can assure gentle tn of in a-Hlition; viz. that tho jeo- nill not make it a ouesuoo oi ... ... ickiiimlifnrftinititvlien-theyii'nce- cuinujilive thiswucaUon; ud fore I take my. seat, if tins House so disposed, I will certainly cn ftvor to shed what light on the bject circumstances may have cu lled me to accumulate. firTirrtertiviibacrveraome-mcthod mJ 1 hMlUng this anbjecte 1 -wiU, Jal, ItWcMJIv iimwifhe wigthalSilaim W t ltro ,ad to theiie lands; Sdly, liarf E rirciimstanres which led to the ion, udil ions oil w hichjjieyere ceded tho General Uovernment; Sdly, 4;t n reasons for present and prompt a?' I m l,,'B ,uttJect w5tM n,ir l,rC" .friM l wants and the uses to w hich this k, id could be applied. Xl"e wim are acquainted with r Colonial history well know that 'nesJI granted to certain gen. urn, known as "Irds. I'roprie- ." a charter for all lands within imrthrrn limits of this State and 'ulliern line of South Carolina, fMrting to extend from the Atlaii. i o in) I'acinc ucean. x hcmb his I'murietora had vested in m, not only the "right of the soil, lie right tu government; and for sea not now necessary to be ad ted to, they surrendered to the vn the risrht of government and ( sequent ly gave up the right of the except ari uranvnir, oo rr ed the right in prtipfTTy in the . Hence it is, all the tit!; tn lands are derived from Lord ftnville, the crown, ami since the eir?6from the State. In the ..rt' t'.'el Canada, and on the Mississippi; and WMt of t)(e Mj,, ,nJ ! Jnorlltof the Lakes ami lite river St jit Lawrence; a war ensued between ! England and JFVance, anllbytbe .. ... ... ......... rated from the rest of this grant;' and we held at that time all of. that land now ronRtiliilini? Rtt i.f . '1'cu ac&e-, -einttttr in an ry yiFC YIT ud ir k. .-p.ii i ,,!,.. jc.i jmnrVeinent. and in a fit of grceioHity we parted with that bet-( ter hair, from winch were ilcshneU ! nevrr again to realise a dollar or re- venues 4 Virginia, Xew "York Connecticut,! Georgia, &c acquired other large trarts of land under circumstances varying in no substantial degree from our acquisition. So ifdis'iive ry, conquest and purchase, united, ran viv. tit! in a mi 11 1 v luiviuut .1 ... .V t .1 , . , e - cuniu tviiihiiimi me oian a nui- I . . 1 . r 1 . . I . (TrilCH III I lit riKllin Ol tllC trilWII III thk immense domain. The circumstances which led to their cession -4o t h Fetlerai Con gress were principally these: In the defence of that liberty which we now enjoy In peace, and in the struggle for-that tndcpendrnrr -if Ettgl and which was attained by so great a nacrifice of blood and treasure, we necessarily had to borrow large sums of. money to support 4 he war waged to secure these ends, as our country was not only new, hut destitute of that large floating capital to be found iu these timeii.rhe SHCCCTsluizler mTnatioh f a war so protracted, left us with an immense debt, "which hung upon this patriotic iand like, an incubus, and threatened to never, nt eji4a7eke4 connected the thirteen old State. During the conflict, the" question was frequently agitated, what should be don: with these lands in the event of a auccessful termination of the war; "the States holding them con tending for all within their charter cd limits." and those without any holding that as they were to be gain ed by mutual sacrifices and losses, they were entitled to a part of them. This quesli in was pregnant with pa- ralysinir diiions anil jealousies. when the. patriots and'atatesmeh of. that day stepped torarJ to chet k the progress of discontent and arrest the serious consequences to which this question was about to lead, and by a resolution or Congress In 170 recommended to the States to aur- rrendcr thrir-wattr iaiulwTbrtie common benefit of the United States. This recommendation was ultimately adopted by all the States holding laud. So much for the condition. which led to their relinquishment. The conditions on-wbicl-tbej were ceded, must he ascertained from looking to the causes which in duced the. aiirrender, and by an ex amination ir the deeds of cession. Some of the causes have already been adverted to; but one- more ' I will now pres into aery ice a little further, to wit: the payment of the nublic debt. -Cnder the articles of confederation Jiquidat'1hkTtfebt contributions .- Wre-mae, by-lhe- States of spcrSfic sums, apportioned 'o their usiuil respective proportions tw the general charge and txpendu lire;" but-there-was no means nor pwer-to:oerceattyatate-iiita-the paymciitof lier. part cither forihis oornnso or for ;t!ieaupjmrii.CT meut. The wisest men were puzzled to devise the ways and means of dis-cJargitiglhisdehUJhft:atteuUoit-tf the patriot, the statesman, , anil jihi loaonher was directed to it, as a sub. ject of disquietude that might lead to results ratal to mat state wuici inry had just attained after ao long and desperate a struggle. These lands were at last pointed to, and with great w isdom too, as the source from whence might be derived' lherrequi. aite funds. T From one of these , grrat caiwr i then alone w hich led to thrir cession, it is not difficult to ascertain the co ditions "on whit h they were relin- uished. North Carolina and V ir- rinia surrendered without remune. o . .. . .. . . ... t I ration; all the other stairs receivm a pecuniary compensation in part, or made large reservations for them selves. The deeds, though varying in words, are substantially as ToU lows: Fr fAe Meant! benefit of ull the S'ntes composing tht Union f aV, nimlimn included ) accardine to thei proportion in the general charge and frneiulilurr: and then shall be faith' fnlltf disposed of for that purpose and Vr.. l.rt fcr' of fivrijn Tt'hfltto ii men toeac Historical nets r it .T ' ' ii'- i ' j :li'l'!l1' . perfectly clear we once this domain: we ceded fw i particular purpostV tOT wili "to constitute a common fund Tor everStt then ,ad iitle t thi the common .benefit, and by the c4which now constitute' the " greater vcaaot they were to be disposed of for f Aat pnrpoie. and'riootuer. Now I need hot ask, Mr. Speak er, any legal gentleman in my hear ing, but I will aubmit it to any mind capable ofcomprehending the import of word, that if that nurnosc and nnn .ll.er" for whirl, the were rr a ii "i iiiswrrtif. oueht ihev not i,iw.i k.rti. ? lr ti.i l.nr theus are removed, and those debts paid off, for which purposes they were roneya to the Uenerai Uov eminent, does it not follow beyond Hie reach uf doubt, th.at the trust bavin been satisfied, the trustee should now pay over to those who made the conveyance bir, it is too plain to require any thing more -I than a statement. I do not wish to be understood as claiming for the States thar jnedcil , -.....liilwn'tirrm---'--ff"l-" proceeds, arising rrotn their sale, for two reason! at, because a large portion of the lands unsold yt;re acqukeiLby irxaljJraaUSiance and Snaiii, which cost in all about 30 millions of dollars and nf ronrse were paid for by the people at large 2dly, I do not think that a native . r m "ii ..I.I oi norm vnrtmiit urniij stateVliy reinovTng to Alabama or j Missouri thereby surrenders . his interest in those lauds which were acquired by the blood and treasure j of hia- anrebt6rs."iriaibiit ' TalfTfie I nett nroceeds should be divided as. indicated in the resolutions; and . sincejtiie GerteraLGvenmeitf-- htdda tJieae zlauuVu and :can -aurveyjyears at-U and sell them, and collect the pro- useless to expect that they will bet ceeU with more uniformity ana despatch' than the separate states' to bo idle in Hie Treasury, or to be things believe I am laboring under n could, it is certainly expedient tliatjcxpewded ttiefcsenra f rtmn fact before me in print, oflicially cd to, and the nett proceeds divided(try, by ihe adoption of a system, of1 coininuuicatcd to Cougreas, I would among the states, rather than the internal imp.'ovement that recog-jiiot hclicve it myself. All. who are lauds. fttisea no object r national, alierejin the habit of regarding the action Let us now enquire whether the . state of thines has arrived, which was anticipated, and by the opera-.al tion of which this branch of revenue is no longer needed by the General .effect valuable purposes? ; Government. We are Informed byj I come now. Sir, to the rrasons the President and tho Secretary if which should induce us to art at the Treasury, that on the 1st day of Januarr. 1835. ever r cent of the national debt will be jiaid off, and a surplus of some millions be left in ground naiy, and now advocated u it bo not national, then they get the the Treasury. So then the great by the President,- that these lands amount in land, I hope T will not end having been attained for which ought to be - surrendered to the be understood as complaining .of the they were: granted," they are no States in which they are located, or ( western members fur obtaining these longer wanted for that purpose, and be sold to them, which Is the same donations; but 1 do complain air. at that astonishing epoch has arrived thing in the end as giving them, that ndicy, whit h takes from a fund in the' history of civilised nations If this tfuestton is not setthfiUhefor created by all and fur ihe "common and is now presented to the worfd, the ' members from the new states ' benefit" of all, to apply it exclusive of nation of IS- to 15 millions of , take their seats - in ' Congress under ly and for a perioil of years to the freemen, living under tltcTTappiest the census of 1840, Ihe West will benefitof a few statej ouly.JJVuttl form of eovernineut known Joa-man-Jiave-ao decided a majurity. that all cannot look " with compassion or e. after having- gone successfully throutrli two want with . the moat powerful and enlightened nation of the world, is not burthened with oiicpasyver our heatl.s, the iulabitanis cent or public debt. Are there najtlij great rnllry or the Jlwslssip to Congress on tins same subject;. I other causes for retaining thiie-vpr and its ' tribHtaries, '"will, "by fear Mr tho opposition in .a certain venue? Let us see. The reports (their "numbers) completely control' high quarter, proceeded more from from the Treasury Department in- the destinies of this ciomtry. ;'-- -: ietMnitr- to-tlip distirtgMisfled-if ate8- form us. that the ordinary rrt rnues of the Uovernment aj-isiofiroin du ties on imMirts nowamoulit to from 3 to S m il lions, more t htiw is neccs- NaryitTpay"! governtneJtt from the.lat-tif 4hia month, we will have in the Treasu ry a surplus of from 5 to 10 millions of dollars annually over tle legiti mate wants f the country, for the aurppuiijOho Federal Govern, ment; and I know of m other fibject tn which this Tum Coutir be appheq that . would bring the . application within the objects of 4he, grsnts 4o-wit.-to. b apjilied -to the-om-j mnn benefit oi all the Mates and no othe - " ' I will now, Mr. Spcakrr, antici pate two objections to this measure, which as they have with Nome plausi bility been made elsewhere, it is to be presumed they may ue nrgeti here. It is held by some, that Con gress has no power (under the Con. stitutiou) to dispose of these lands, oi- uf their nrnrceus anions uie Statesrbecause they were conreyeTpra does not relinquish or impair his .y?r.f the Const it utionwas aiiiqit ed." There are two effectual an. swers to that objection 1st, tliere is nothing in the deeds themselves to prohibit such a disposition, but lliey shew on their face it was a trust fund created in the General Govern raent and the right ' to return what is left aftef accompliabing lbs object of the grant, to the grantee, follows necessarily. , reuer al Constitution was adapted it h true, si ure these lands were convey, etl, but the States that ceded , them have subsequently ' ratified , ' adunfed 'tht ('oMa'U'vo: q,t .1 fftol being the last net must govtrn, niip posing 1 the two to be inronNistent. which I tlcny. Again all (lie land ceded by Georgia, as well ' as that purchased from Spain and France,! they may be fairlyvalued at 10 to ..i . .a t - r:iTi 1'. . I. ' "... I I .1 fir?Ii.!.,5.-l,.l!,' public. , Uudit,I.miUi!tt,nX dollacs tlM -thwe Statea were obtained by the general gov eminent a i nee J lie adoption of the Federal Constitution: and if there ran be any doubt in regard to this quentioii as - Constitutional one, I tiiff pliuii worils of the Sdserfiou of thc,4lii - - ai lids lif the IhiHstililltoi w ill dispose of that dmitit it rends thus 'Congress shall have junrer t dispose of and make all needful rules and regulations respecting the lerritary and " othi'r" jit operty of tTe United States?' t. I most aay, Sir, in candour, t ran scarcrly he lieve any man of sense sp'ki Hie tititli, when he prort-HHcs to doubt the constitutional right of Congress over the public lauds as herein re commended. Ano( her objection ureed nruinst auh-tftttresn"mpirT( rnreTovTiorf but they now begin, to cry out the wants of eovernment. and make up the tlpfii ieiiry ou of this Hates nf the public lauds. That was a plaosible.Jirp;-owHpebpn at-the-Hhrsr time Mr. II ay ne resorted to it hut if nir"Ttinger "njipiies. for now tlie, grants ii. such favorable terms? Tariff is settled and fixed by a coin-j Why ir we might as well he stir promise, at a certain rate of duties pissed at the prosperity of a young fur ten viN! ami mi llin m i m inlo . J . 7" ? ' ' -. .. . . . . . . . . . if th" attempt were mdo. The principle and rate of duties being reuureu. is tueii una 3 inuiious; votes . cannot be bought? or should it be paid over to its real and origin owners, the Statrs, who stand in need of its aid, and with it might present, and promptly on this mat-: ter. An opinion or idea is now pr hope of this resource will be,cut off, forever. It retiuires no prrtihet to rcaer, that before many yen st.nl 1 I hare said, to son .these lands too, that the rates shall be i fully ade. by witha henry purse; out of which quale to the wants of goveruuient; he bought liim land, bought him the no person in his senses is disposed hands, cut his ditches, made , his to disturb that.queslion now; .nor jroad.s, and built his houses." Coder wnTifd he be ao tierinitted f iiresutne.; such a state of things could he help lo tho new States Avould be " tanta-Seit mount to giving them, ftr hyw ni 'Iff J'iftVfn sr Take one Statoas an example. II - linois had 1 58,600 3njdafi6ii, Tint about 31 t-2 nnU4fn) oil i acree ofi punuc laVgnsT iViw u wo soin this to hcrsvt the minimum price it would amonnt "tnTiearly4anfniniofiirtif tloll.irs, or at hairprlraHo lions of thdlara Cfd she.s pay for it? Sir, rould she ever pay the interest on that sum, which would exceed a million annually? And pray how could w enlerce payment? f'f K jou retained . a mortgage on the land they would not sell. To talk then of selling them Is to me erfect nonsense, if : I tnsy be par- doncd the word; and to give them away, -(dropping Ihe constitutional right a to dispose of them,) w hat tea son oil earth can be assigned for making such a donation to these States? For whilst 1 admit that a native of Virginia or North Carol i- r,s!'.tjithisilmaia4y-removing south or west t ,000 mil-s, L am at a loss to conceive by what rules of in duction any one ran infer by bo moving he acquires any new claims. Again, Sir, let .us now are what has already been N done" for these new states, t- jI' read from a re nortvroade on an oSeial call from Congress. Grants of Lands to the Western States. -r' - -M t The toik teat ton Sot Publi StKoeta 1.00, 000 8 Far lot. lmyretemeat In W, Stair it.ftKtJKJU 3 Kor College o'l UuirM.M- w lo t0 OO0 4 For Religion k cliaruakle kiMauiHilit 9O,0tal 5 For ttoi State liTeiaiBi 81,0110 , ( Salia IUeraiion. .il.oiiO Tot.t no. nfaere ri antet lh .'..Wsat .1 ft Is to be kept in mind, that in all these-grants, they are permitted to iclrt t the lauds and anil them oh any credit ther please. On these terms 815 per acre. About one hundred have already recrited; add now. the pre emption right, and the 5 per cent, on the amount of the sale in their boundaries, and a reasonable man wooltl stirWtedj JsJX'USR! increases the appetite for further in. diligences. They come forwtrd-ahd ask appropriations of money to clear out every river and creek in the Western Status, and to audi an rx.iorgufL-jun-lhft part 4tf thGeneral tent itnis HvaHdoiiS MpiiMl t arried, that last winter it in said, a large appropriation was made to rlar out a river that had no water in it, hut the bt d of wli o h was completely dry. They ar not content with having all their roads and rivers cleaned out, college, public Heli'Mils and cap the a large pofJloui" iof UbCiaiiiE M fur the whole' ..Can any one biiHiir- priieil at the extraordinary pros perity or t.m WesternStates uiiiler rtrxnrmflCcsT Was ever a country on earth opened to rmi Tii'iMWt wlirt Im4 --fathll -t .lomliw" - - - - - - - ........ -------- n Jrospering2 .'I'ho only thing tliat surpiises me is, that the old State; No doubt, Mr, Speaker, those wno nave pain noaueniion to uiest1 'of Congress on this subject know "ton well, the tarts here staled; ami those who are not have but to turn Jo tho acts passed at any session of Congress for tnany yvars (iasf,1o aee fho-dnatiim unand riiatie for some asylum, college,1 or rrerk. that is not considered ntdional; for if 'it be a national river or rrrrfc. 'the get the muncy votetl drrwtiyjhuf ten with a proper feeling of respect on those, meuibers from tho old 1 States w holiaiefoTlhetasT fwo years opposed the measures inf mducrd iu man who rrieinated tor hilt i hat lias by largi? n TiVf r, t ha ir froin w hat wa !muus must liaie,.8iiiu,e irftiiiu forl-hia .course, and as . those assigned ate admitted to be mere uiTWtaf ious, I am at a loss for any nl.ier cause than the one hinted at.And tt ia a HUKicieiii cause to decide tne couiar of .many miserable creatures iu CoogrYil 'ii'Mtl'knowni only a subject fr boastiiix but I in road to political ollice Willi th peo pie,) to leant how the w j o dh jo w aji tioiiTa ceitairt quarter, to shape their course accordingly . "T7 " But to return to the, question Is the applirntien of this t-omniou fund, general .among the Statra, or is it partial? Let as examine. l ; wil ask the gentleman I nun Iho Albemarle country , how ; many sp idea v full of sand has tha ; (ienenil (loiernment removed from Cuniturk 1 Inlet or Nagg's Head, once outlets to the sea, now as dry as this fluoi ? has a log or Sand bar bern removed from one of your rivrriirfrom the sound? you all answer fm. Iet me auk my friends from! inwiiokr yes and also from the Nrue, Tar, Yailkin and Catawbit how many dams a- cross your, rivers has th Ueoerai Government erected toimprove your! navtration, or how. many snajts and sand-bars have been removed by her?,' Again Sir, when has a dollar or an acre of this public domain that our ancestor acquli-ed hy audi sac ilfices ami 'sufferings, been granted to North Carolina ..either Tor. n'.f '.' mon school, college, or evenanf B ? J In itJl .fo rtjUe UJifiMtunate?T-notMue rent: if so, I should like to hear ott There is. a thins abovellinr sand wrarertold near llcracokei "where-"? nothing hnt the' immutable lawsoT hydmstatics prevent us frnra being ? completely land locked; the apprn prialion fir., ihU object which was . not desired by. SO men in the State, and is ofuo acoiint now, nor w as it e ver designed to be;, and that at the Cape Frar amounted to about Z20, OOd AVhen.our share of the proceeds have been 826,000.-v....,:Vti.?'x.. Will -nny gentleman lie rrpoint me our n itoail or uanal, a uol lege, a SchiHiNliouse, or anv thing. ttovernment to improve the physl ml condition of N. Carolina, or the moral condition of her pcoplt-2 fear none can show me the place, oi the appropriation still she has had the Use of our lands, and re reived our revenue for 50 years.-; Every river anl cm'X,JLtklJioi)H l0fHffrnn at, and so rtearrd iut; but our il vera running directly Into the tea, nr into large sounds are ronsidcrrd unwor. thy of rioijer. It is highly NnlI.,.L.. Iiiiiiiil anil fur tlir. riiin.r.iii liinRr to jjive laod fortho jurpoe nfedy, T .---"" ...., rating an me poor t iiuiiren tu Ala bama and Mississippi, but neither National nor rir the fcommon hrne.. fiTZToITiVake slmiiar jlonationa fr education of poor children 1 in N. Carolina. And why is this so; and alio am to blame? j We are solely Ji btaineiirs'elv theso h fogs rould have been r rot merely by asking fuj; llirm; and cause why wjiavjJsjYma.iurdJie ways hanging on some great man's -skirt and worshipping him constant ly, instead Ml'atleiuifng to- Hfirrtw domestic wants. EveraitHcl jTtl.--. reBmW'nliete in this state, divided Into two classes. Una I arge d ass h a vr remained in a sfatf . , 7 of -toqiorr-regardless Tof all th'tngjtjr: and the balance have bee trying to elect sooe particular titan IVrsidenl, who, la return has treated, them with aileiit contempt; or attempting , lo stuff down tb people some ab- sIrrtQndjticaIdt let tul era did r not tinderst and throw st ives, and ' which ' rotildt affi'i t N. Carolina in ' no nhape or foruil whether s the notion of some great ' man" fniiri Virglitlirw Sfii'ttrCarni'''"'" na was orthodox ir heterodox;! say Virginia jiir;S Carolina jVe cause ; there we havf been taught, to look' Tor' great 'inejj fir Jf a tiati "k son with the' wisdom ;.nf Sotonioii and rliMjuence of Cicero, lived in N. Carolina, he would be rated at home an oidinary man and that atroi.g disMbili.n : la nur people at watch- . fnl to suppress ineiit, would rise ami f destroy him before he" cmild have an opNii'lonity tif being kuowir. ; . l,aV"! dun iins Hiiort.npnarcutni!ri'Csiiin. Ijiit I 'bT'lTevf this tirjiavi been one, if not the ' great reason, why " this Statu and the4people of Jf, Carolina hate been so neglected. . .1 will tc turn to Ihe .Itinds,.,,., a4.: t It appears front the SecrelarV in IhOeasiry jrrjiili he net t pr. -cents of the ptiblit: lands i for the ' ttt'Si Sexi eedrtl 4 millions, and that UW ',i4 wll b-5iMton of tlofliirwr" Now- if this land which i sent inly free frioii all liens and n aurplus funtl in .t..i'.o hand tf girvernmriit hhiiuM be; 'divided accoi diiig to fed. eral 'popnlatioii 'aiiioiig 'the Stalelf, NilJ-l"0!,',' hail , firsfy fri3i;Sfftjof:.ii'sii year 7 i87,ow; and now this'trry liio me'nt we would have been entitled to "" ;22SyClQ0 - iir - rOo art -of th c Skies of last year. ; But this. Sir, is held - to lie aauiall affair in roinpariaoH lo ' the lute which many have forcer. . tain great men and 'should be hint without a moment hesitation Sooner ' than displease Gen. ! Jackson.-' It . apjieftis front estimates, iho Guv erninent.now has about 10; niilliohs"' of acres of land sunejeil; bm1 that there is a billion and go-million nf acri s now1 hnsold belonging tn this common fond., The ideal ofsur- rciideiln this ljiP.stL propetfy, ur giving it away. can to my inind scan ry be, dreamed of, juorh Kps i really. ronlemplateil; by any f a ioual , man. . I will afford a constantly iH creasing fountain from whenca thn old btatrs - may - reap a revenue, that will tnabls them fo overcome tbu many obstructions by nature to their prosperity and to elevate tbe' rnoral ,. and intellectual siaisoimeir iKt.pif1. I tomu;"iow j fi tliu luit bi ancli of the ewulry. itjJJiy fartlie iimst -dissgreeabfe to inc. 6 pn ds- . terniiiie'tj o Up d 1st ioct ly Mflffit'taii1 " My Tarts tyott ytIL will admn-e-aud , tha44ifcreiM-hall-be-fM plain an4 , .jt.- "at. 4" . 1 , . ) -. i S,
The North-Carolina Star (Raleigh, N.C.)
Standardized title groups preceding, succeeding, and alternate titles together.
March 12, 1835, edition 1
1
Click "Submit" to request a review of this page. NCDHC staff will check .
0 / 75